PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G101000.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 322aa    MW: 36998 Da    PI: 9.9092
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G101000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.57.1e-25199248352
              RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ++i led+ k+F lpi +A+++L+v+lTvLKr+CR++GI+RWPhRkiksl
  Potri.005G101000.2 199 ARIALEDVVKCFGLPIVEASRNLKVGLTVLKRKCRELGIPRWPHRKIKSL 248
                         6899********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.11183268IPR003035RWP-RK domain
PfamPF020429.6E-20201248IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MASSLIALLV FENNINKELV RSLHVYRLKD GKEKEVEREF VFSVDGPYVE MKAGPILRLR  60
RFQVLELFEG QVIGLWRCIF AFHVNNPPHL SHSSFLLSVS RNPKLKSIPT LAKDIHFILK  120
LSCKTDNEEP SRFSSKEICE VDRDNCHQSK KSLPVLDQDL NCLPNSVSPS ELSKSEQIEL  180
CAAGVMEKKK KRAASEDIAR IALEDVVKCF GLPIVEASRN LKVGLTVLKR KCRELGIPRW  240
PHRKIKSLDS LICSLQEEAE RHKQDNEDTT MAVAKRRRML EREKETIEKK PFMEIQSETK  300
RFRQDVFKRR HRARALGNQG L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011022165.10.0PREDICTED: protein RKD5 isoform X1
SwissprotO817916e-94RKD5_ARATH; Protein RKD5
TrEMBLB9H6680.0B9H668_POPTR; RWP-RK domain-containing family protein
STRINGPOPTR_0005s10400.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.12e-91RWP-RK domain-containing protein